PDB entry 2pe7

View 2pe7 on RCSB PDB site
Description: Thaumatin from Thaumatococcus Danielli in complex with tris-dipicolinate Europium
Class: plant protein
Keywords: Thaumatin, Tris-dipicolinate Europium, X-Ray, PLANT PROTEIN
Deposited on 2007-04-02, released 2008-04-22
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-22, with a file datestamp of 2008-04-18.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.153
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Preprothaumatin I
  Species: Thaumatococcus daniellii
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1IIJ1 (0-206)
  Domains in SCOP 1.75: d2pe7a1
• Heterogens: EU, TLA, PDC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pe7A (A:)
  atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
  sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
  crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
  fsyvldkpttvtcpgssnyrvtfcpta