PDB entry 2pe1

View 2pe1 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF HUMAN PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 (PDK1) {2-Oxo-3-[1-(1H-pyrrol-2-yl)-eth-(Z)-ylidene]-2,3-dihydro-1H-indol-5-yl}-urea {BX-517} COMPLEX
Class: transferase
Keywords: protein inhibitor complex, serine kinase
Deposited on 2007-04-01, released 2007-06-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-07-17, with a file datestamp of 2007-07-13.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.224
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide-dependent protein kinase 1
    Species: HOMO SAPIENS
    Gene: PDPK1, PDK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15530 (0-285)
      • modified residue (167)
    Domains in SCOP 1.73: d2pe1a1
  • Heterogens: SO4, 517, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pe1A (A:)
    prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
    msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
    eylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspel
    lteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlv
    ekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pe1A (A:)
    prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
    msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
    eylhgkgiihrdlkpenillnedmhiqitdfgtakvlsfvgtaqyvspellteksackss
    dlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatk
    rlgceemegygplkahpffesvtwenlhqqtppklt