PDB entry 2pe0

View 2pe0 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF HUMAN PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 (PDK1) 5-Hydroxy-3-[1-(1H-pyrrol-2-yl)-eth-(Z)-ylidene]-1,3-dihydro-indol-2-one COMPLEX
Class: transferase
Keywords: protein inhibitor complex, serine kinase, transferase
Deposited on 2007-04-01, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PDPK1, PDK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15530 (0-285)
      • modified residue (167)
    Domains in SCOPe 2.08: d2pe0a_
  • Heterogens: SO4, 39Z, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pe0A (A:)
    prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
    msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
    eylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspel
    lteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlv
    ekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pe0A (A:)
    prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
    msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
    eylhgkgiihrdlkpenillnedmhiqitdfgtakvlsfvgtaqyvspellteksackss
    dlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatk
    rlgceemegygplkahpffesvtwenlhqqtppklt