PDB entry 2pde

View 2pde on RCSB PDB site
Description: the high resolution structure of the peripheral subunit-binding domain of dihydrolipoamide acetyltransferase from the pyruvate dehydrogenase multienzyme complex of bacillus stearothermophilus
Class: transferase
Keywords: oxido-reductase, acyltransferase, transferase
Deposited on 1992-11-25, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide acetyltransferase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pdea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pdeA (A:)
    viampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga