PDB entry 2pdd

View 2pdd on RCSB PDB site
Description: the high resolution structure of the peripheral subunit-binding domain of dihydrolipoamide acetyltransferase from the pyruvate dehydrogenase multienzyme complex of bacillus stearothermophilus
Deposited on 1992-11-25, released 1994-12-20
The last revision prior to the SCOP 1.57 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2pdd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pdd_ (-)
    viampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga