PDB entry 2pd6

View 2pd6 on RCSB PDB site
Description: Structure of human hydroxysteroid dehydrogenase type 8, HSD17B8
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase, steroid metabolism, lipid metabolism, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2007-03-31, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B8, FABGL, HKE6, RING2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92506 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d2pd6a_
  • Chain 'B':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B8, FABGL, HKE6, RING2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2pd6b_
  • Chain 'C':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B8, FABGL, HKE6, RING2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2pd6c_
  • Chain 'D':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B8, FABGL, HKE6, RING2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2pd6d_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pd6A (A:)
    mqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgskegp
    prgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkvi
    avnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaa
    relgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflased
    sgyitgtsvevtgglfmaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pd6A (A:)
    mqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqadv
    searaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtq
    aaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircns
    vlpgfiatpmkitemipmghlgdpedvadvvaflasedsgyitgtsvevtggl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pd6B (B:)
    mqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgskegp
    prgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkvi
    avnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaa
    relgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflased
    sgyitgtsvevtgglfmaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pd6B (B:)
    lrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllgnhaafqadvsea
    raarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtqaaa
    qalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircnsvlp
    gfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvevtggl
    f
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pd6C (C:)
    mqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgskegp
    prgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkvi
    avnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaa
    relgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflased
    sgyitgtsvevtgglfmaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pd6C (C:)
    alalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqadvsearaar
    clleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtqaaaqalv
    sngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircnsvlpgfia
    tpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvevtgglf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pd6D (D:)
    mqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgskegp
    prgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkvi
    avnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaa
    relgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflased
    sgyitgtsvevtgglfmaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pd6D (D:)
    nrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqadvse
    araarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtqaa
    aqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircnsvl
    pgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvevtgg
    lf