PDB entry 2pcy

View 2pcy on RCSB PDB site
Description: the crystal structure of poplar apoplastocyanin at 1.8-angstroms resolution. the geometry of the copper-binding site is created by the polypeptide
Class: electron transport protein(cuproprotein)
Keywords: electron transport protein(cuproprotein)
Deposited on 1983-11-03, released 1984-02-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: Populus nigra
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00299 (0-98)
  Domains in SCOP 1.73: d2pcya_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pcyA (A:)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn