PDB entry 2pcu

View 2pcu on RCSB PDB site
Description: Human carboxypeptidase A4 in complex with a cleaved hexapeptide.
Class: hydrolase
Keywords: metallocarboxypeptidase; metalloprotease; product; cleavage; specificity; human carboxypeptidase A4
Deposited on 2007-03-30, released 2007-04-17
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-17, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.159
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a4
    Species: HOMO SAPIENS
    Gene: CPA4, CPA3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2pcua1
  • Chain 'B':
    Compound: peptide
    Species: synthetic, synthetic
  • Heterogens: NAG, ZN, SCN, ASP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pcuA (A:)
nnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpavw
lnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqtqn
rlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvdfi
qkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvgpt
cttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktimeh
vrdnl

  • Chain 'B':
    No sequence available.