PDB entry 2pcu

View 2pcu on RCSB PDB site
Description: Human carboxypeptidase A4 in complex with a cleaved hexapeptide.
Class: hydrolase
Keywords: metallocarboxypeptidase; metalloprotease; product; cleavage; specificity; human carboxypeptidase A4, HYDROLASE
Deposited on 2007-03-30, released 2007-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CPA4, CPA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pcua1
  • Chain 'B':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2PCU (0-4)
  • Heterogens: NAG, ZN, SCN, GOL, ASP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pcuA (A:)
nnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpavw
lnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqtqn
rlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvdfi
qkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvgpt
cttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktimeh
vrdnl

  • Chain 'B':
    No sequence available.