PDB entry 2pcp

View 2pcp on RCSB PDB site
Description: antibody fab complexed with phencyclidine
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1998-06-02, released 1999-01-27
The last revision prior to the SCOP 1.75 freeze date was dated 1999-01-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-215)
      • conflict (26)
      • conflict (26)
      • conflict (56)
      • conflict (96)
      • conflict (98)
      • conflict (100)
    Domains in SCOP 1.75: d2pcpa1, d2pcpa2
  • Chain 'B':
    Compound: immunoglobulin
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d2pcpb1, d2pcpb2
  • Chain 'C':
    Compound: immunoglobulin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-215)
      • conflict (26)
      • conflict (26)
      • conflict (56)
      • conflict (96)
      • conflict (98)
      • conflict (100)
    Domains in SCOP 1.75: d2pcpc1, d2pcpc2
  • Chain 'D':
    Compound: immunoglobulin
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d2pcpd1, d2pcpd2
  • Heterogens: 1PC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcpA (A:)
    dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcpB (B:)
    evqlqqsgpelvkpgasvkmsckasgytftdyyihwnkqshgkslewigyiypnnggngy
    nhkfkgkatltvdkssstaymdvrtltsedsavyycgrstwddfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtssprpsetvtcnvahpasstkvdkkiv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcpC (C:)
    dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcpD (D:)
    evqlqqsgpelvkpgasvkmsckasgytftdyyihwnkqshgkslewigyiypnnggngy
    nhkfkgkatltvdkssstaymdvrtltsedsavyycgrstwddfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtssprpsetvtcnvahpasstkvdkkiv