PDB entry 2pcp

View 2pcp on RCSB PDB site
Description:
Deposited on 1998-06-02, released 1999-01-27
The last revision prior to the SCOP 1.71 freeze date was dated 1999-01-27, with a file datestamp of 1999-01-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2pcpa1, d2pcpa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2pcpb1, d2pcpb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2pcpc1, d2pcpc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2pcpd1, d2pcpd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcpA (A:)
    dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcpB (B:)
    evqlqqsgpelvkpgasvkmsckasgytftdyyihwnkqshgkslewigyiypnnggngy
    nhkfkgkatltvdkssstaymdvrtltsedsavyycgrstwddfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtssprpsetvtcnvahpasstkvdkkiv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcpC (C:)
    dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcpD (D:)
    evqlqqsgpelvkpgasvkmsckasgytftdyyihwnkqshgkslewigyiypnnggngy
    nhkfkgkatltvdkssstaymdvrtltsedsavyycgrstwddfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtssprpsetvtcnvahpasstkvdkkiv