PDB entry 2pcf

View 2pcf on RCSB PDB site
Description: the complex of cytochrome f and plastocyanin determined with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
Class: complex (electron transport proteins)
Keywords: electron transport, paramagnetic, chemical shift, complex formation, dynamic complex, photosynthesis, pseudocontact shift, complex (electron transport proteins)
Deposited on 1997-12-22, released 1998-04-08
The last revision prior to the SCOP 1.73 freeze date was dated 1998-04-08, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: Spinacia oleracea
    Gene: PETE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2pcfa_
  • Chain 'B':
    Compound: cytochrome f
    Species: Brassica rapa
    Gene: PETE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2pcfb_
  • Heterogens: CU, HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcfA (A:)
    vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
    dllnapgetykvtltekgtykfycsphqgagmvgkvtvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcfB (B:)
    ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
    langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
    qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnntvynataggiis
    kilrkekggyeitivdasnerqvidiiprglellvsegesikldqpltsnpnvggfgqgd
    aeivlqdplr