PDB entry 2pc9

View 2pc9 on RCSB PDB site
Description: Crystal Structure Of ATP-Dependent Phosphoenolpyruvate Carboxykinase From Thermus thermophilus HB8
Class: lyase
Keywords: Phosphoenolpyruvate Carboxykinase, adenosine triphosphate, Thermus thermophilus HB8, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2007-03-29, released 2007-10-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pc9a1, d2pc9a2
  • Chain 'B':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pc9b1, d2pc9b2
  • Chain 'C':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pc9c1, d2pc9c2
  • Chain 'D':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pc9d1, d2pc9d2
  • Heterogens: CA, PO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pc9A (A:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc9A (A:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvl
    ivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgkttlstdp
    erpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvvnpesr
    rvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarlspeeam
    yyflsgytarvtepratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwtggp
    ygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretwadk
    eaydqqarklarlfqenfqkyasgvakevaeagpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pc9B (B:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc9B (B:)
    qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
    epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
    spwhalfarnmfilprrffvpgftvvhapyfqavperdgtrsevfvgisfqrrlvlivgt
    kyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgkttlstdperpl
    igddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvvnpesrrvqw
    dddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarlspeeamyyfl
    sgytartepratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwtggpygvgy
    rfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretwadkeaydq
    qarklarlfqenfqkyasgvakevaeagprt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pc9C (C:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc9C (C:)
    rlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvre
    pevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvtes
    pwhalfarnmfilprrfgnveafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvl
    ivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgkttlstdp
    erpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvvnpesr
    rvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarlspeeam
    yyflsgytarvtepratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwtggp
    ygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretwadk
    eaydqqarklarlfqenfqkyasgvakevaeagprte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pc9D (D:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc9D (D:)
    qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
    epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
    spwhalfarnmfilprrfgafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvliv
    gtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgkttlstdper
    pligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvvnpesrrv
    qwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarlspeeamyy
    flsgytarvpratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwtggpygvg
    yrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretwadkeayd
    qqarklarlfqenfqkyasgvakevaeagprt