PDB entry 2pc6

View 2pc6 on RCSB PDB site
Description: Crystal structure of putative acetolactate synthase- small subunit from Nitrosomonas europaea
Class: lyase
Keywords: acetolactate synthase, regulatory subunit, structural genomics, psi, protein structure initiative, midwest center for structural genomics, mcsg, lyase
Deposited on 2007-03-29, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable acetolactate synthase isozyme III (Small subunit)
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: ilvH, NE1324
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82UZ2 (2-164)
      • expression tag (1)
    Domains in SCOPe 2.08: d2pc6a1, d2pc6a2, d2pc6a3
  • Chain 'B':
    Compound: Probable acetolactate synthase isozyme III (Small subunit)
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: ilvH, NE1324
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pc6b1, d2pc6b2
  • Chain 'C':
    Compound: Probable acetolactate synthase isozyme III (Small subunit)
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: ilvH, NE1324
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82UZ2 (2-164)
      • expression tag (1)
    Domains in SCOPe 2.08: d2pc6c1, d2pc6c2, d2pc6c3
  • Chain 'D':
    Compound: Probable acetolactate synthase isozyme III (Small subunit)
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: ilvH, NE1324
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pc6d1, d2pc6d2
  • Heterogens: CA, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pc6A (A:)
    ghmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeive
    qitkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtne
    lytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc6A (A:)
    hmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeiveq
    itkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnel
    ytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pc6B (B:)
    ghmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeive
    qitkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtne
    lytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc6B (B:)
    mrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeiveqi
    tkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnely
    tieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pc6C (C:)
    ghmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeive
    qitkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtne
    lytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc6C (C:)
    hmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeiveq
    itkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnel
    ytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pc6D (D:)
    ghmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeive
    qitkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtne
    lytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc6D (D:)
    mrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeiveqi
    tkqlnklivvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnelyt
    ieltgtrskldgflqavdcnlileiartgvsglsrgervlkl