PDB entry 2pc5

View 2pc5 on RCSB PDB site
Description: Native crystal structure analysis on Arabidopsis dUTPase
Class: hydrolase
Keywords: dUTPase, Arabidopsis, Magnesium, HYDROLASE
Deposited on 2007-03-29, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DUTP pyrophosphatase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: T6H20.30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pc5a_
  • Chain 'B':
    Compound: DUTP pyrophosphatase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: T6H20.30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pc5b_
  • Chain 'C':
    Compound: DUTP pyrophosphatase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: T6H20.30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pc5c_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pc5A (A:)
    gshmacvnepspklqkldrngihgdsspspffkvkklsekaviptrgsplsagydlssav
    dskvpargkaliptdlsiavpegtyariaprsglawkhsidvgagvidadyrgpvgvilf
    nhsdadfevkfgdriaqliiekivtpdvvevddldetvrgdggfgstgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc5A (A:)
    spffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyari
    aprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpdv
    vevddld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pc5B (B:)
    gshmacvnepspklqkldrngihgdsspspffkvkklsekaviptrgsplsagydlssav
    dskvpargkaliptdlsiavpegtyariaprsglawkhsidvgagvidadyrgpvgvilf
    nhsdadfevkfgdriaqliiekivtpdvvevddldetvrgdggfgstgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc5B (B:)
    pspffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyar
    iaprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpd
    vvevdd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pc5C (C:)
    gshmacvnepspklqkldrngihgdsspspffkvkklsekaviptrgsplsagydlssav
    dskvpargkaliptdlsiavpegtyariaprsglawkhsidvgagvidadyrgpvgvilf
    nhsdadfevkfgdriaqliiekivtpdvvevddldetvrgdggfgstgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pc5C (C:)
    spffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyari
    aprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpdv
    vevddld