PDB entry 2pc0

View 2pc0 on RCSB PDB site
Description: Apo Wild-type HIV Protease in the open conformation
Class: hydrolase
Keywords: HIV protease, HYDROLASE
Deposited on 2007-03-29, released 2007-06-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.155
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot A3FH86 (0-98)
    • engineered (6)
  Domains in SCOPe 2.03: d2pc0a_
• Heterogens: MG, PGR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pc0A (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf