PDB entry 2pbz

View 2pbz on RCSB PDB site
Description: Crystal structure of an IMP biosynthesis protein PurP from Thermococcus kodakaraensis
Class: ligase
Keywords: NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PurP, 10188d, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, LIGASE
Deposited on 2007-03-29, released 2007-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.276
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Thermococcus kodakarensis [TaxId:69014]
    Gene: PurP, TK0431
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JD28 (3-311)
      • modified residue (53)
      • modified residue (237)
      • modified residue (289)
    Domains in SCOPe 2.07: d2pbza1, d2pbza2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Thermococcus kodakarensis [TaxId:69014]
    Gene: PurP, TK0431
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JD28 (3-311)
      • modified residue (53)
      • modified residue (237)
      • modified residue (289)
    Domains in SCOPe 2.07: d2pbzb1, d2pbzb2
  • Chain 'C':
    Compound: hypothetical protein
    Species: Thermococcus kodakarensis [TaxId:69014]
    Gene: PurP, TK0431
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JD28 (3-311)
      • modified residue (53)
      • modified residue (237)
      • modified residue (289)
    Domains in SCOPe 2.07: d2pbzc1, d2pbzc2
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pbzA (A:)
    mslivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnd
    dgivvphgsfvaylgieaiekakarffgnrrflkwettfelqdkalegagiprvevvepe
    dakpdelyfvriegprggsghfivegseleerlstleepyrverfipgvylyvhffyspi
    lerlellgvdervliadgnarwpvkplpytivgnraialresllpqlydyglafvrtmre
    leppgvigpfalhfaydgsfkaigiasridggsnadhwyselywgerlsmgrriarelrl
    aeeedrleevvteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pbzA (A:)
    ivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnddgi
    vvphgsfvaylgieaiekakarffgnrrflkwettfelqdkalegagiprvevvepedak
    pdelyfvriegseleerlspyrverfipgvylyvhffyspilerlellgvdervliadgn
    arwpvkplpytivgnraialresllpqlydyglafvrtmreleppgvigpfalhfaydgs
    fkaigiasridggsnadhwyselywgerlsmgrriarelrlaeeedrleevvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pbzB (B:)
    mslivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnd
    dgivvphgsfvaylgieaiekakarffgnrrflkwettfelqdkalegagiprvevvepe
    dakpdelyfvriegprggsghfivegseleerlstleepyrverfipgvylyvhffyspi
    lerlellgvdervliadgnarwpvkplpytivgnraialresllpqlydyglafvrtmre
    leppgvigpfalhfaydgsfkaigiasridggsnadhwyselywgerlsmgrriarelrl
    aeeedrleevvteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pbzB (B:)
    ivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnddgi
    vvphgsfvaylgieaiekakarffgnrrflkwettfelqdkalegagiprvevvepedak
    pdelyfvriegseleerlspyrverfipgvylyvhffyspilerlellgvdervliadgn
    arwpvkplpytivgnraialresllpqlydyglafvrtmreleppgvigpfalhfaydgs
    fkaigiasridggsnadhwyselywgerlsmgrriarelrlaeeedrleevvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pbzC (C:)
    mslivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnd
    dgivvphgsfvaylgieaiekakarffgnrrflkwettfelqdkalegagiprvevvepe
    dakpdelyfvriegprggsghfivegseleerlstleepyrverfipgvylyvhffyspi
    lerlellgvdervliadgnarwpvkplpytivgnraialresllpqlydyglafvrtmre
    leppgvigpfalhfaydgsfkaigiasridggsnadhwyselywgerlsmgrriarelrl
    aeeedrleevvteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pbzC (C:)
    ivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnddgi
    vvphgsfvaylgieaiekakarffgnrrflkwettfelqdkalegagiprvevvepedak
    pdelyfvriegseleerlspyrverfipgvylyvhffyspilerlellgvdervliadgn
    arwpvkplpytivgnraialresllpqlydyglafvrtmreleppgvigpfalhfaydgs
    fkaigiasridggsnadhwyselywgerlsmgrriarelrlaeeedrleevvt