PDB entry 2pbq

View 2pbq on RCSB PDB site
Description: Crystal structure of molybdenum cofactor biosynthesis (aq_061) From aquifex aeolicus VF5
Class: lyase
Keywords: molybdopterin, MPT, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2007-03-29, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis MOG
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pbqa_
  • Chain 'B':
    Compound: Molybdenum cofactor biosynthesis MOG
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pbqb_
  • Chain 'C':
    Compound: Molybdenum cofactor biosynthesis MOG
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pbqc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pbqA (A:)
    msekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektl
    ieladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsr
    qtagirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pbqA (A:)
    kavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliela
    dekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqtag
    irgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pbqB (B:)
    msekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektl
    ieladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsr
    qtagirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pbqB (B:)
    kkavigvvtisdedisgkaiidylkdviitpfeveyrvipderdliektlieladekgcs
    lilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqtagirgscl
    ivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pbqC (C:)
    msekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektl
    ieladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsr
    qtagirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pbqC (C:)
    kkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliel
    adekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqta
    girgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafr