PDB entry 2pbk

View 2pbk on RCSB PDB site
Description: Crystal structure of KSHV protease in complex with hexapeptide phosphonate inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: kshv, kshv protease, herpesvirus protease, viral protease, viral protein, hydrolase-hydrolase inhibitor complex
Deposited on 2007-03-28, released 2007-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.163
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KSHV protease
    Species: Human herpesvirus [TaxId:37296]
    Gene: AF010430
    Database cross-references and differences (RAF-indexed):
    • Uniprot O36607 (0-227)
      • engineered (201)
    Domains in SCOPe 2.08: d2pbka_
  • Chain 'B':
    Compound: KSHV protease
    Species: Human herpesvirus [TaxId:37296]
    Gene: AF010430
    Database cross-references and differences (RAF-indexed):
    • Uniprot O36607 (0-227)
      • engineered (201)
    Domains in SCOPe 2.08: d2pbkb_
  • Chain 'C':
    Compound: hexapeptide phosphonate inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2PBK (Start-5)
  • Chain 'D':
    Compound: hexapeptide phosphonate inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2PBK (Start-5)
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pbkA (A:)
    qglyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvs
    hgifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihpre
    lsqtpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrle
    dlstpnfvspletlmakaidagfirdrldllktdrgvasilspvylka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pbkB (B:)
    qglyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvs
    hgifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihpre
    lsqtpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrle
    dlstpnfvspletlmakaidagfirdrldllktdrgvasilspvylka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pbkB (B:)
    qglyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvs
    hgifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihpre
    lsqpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrled
    lstpnfvspletlmakaidagfirdrldllktdrgvasilspvylka
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.