PDB entry 2pbi

View 2pbi on RCSB PDB site
Description: The multifunctional nature of Gbeta5/RGS9 revealed from its crystal structure
Class: signaling protein
Keywords: Helix wrap, RGS domain, DEP domain, DHEX domain, GGL domain, Beta propeller, SIGNALING PROTEIN
Deposited on 2007-03-28, released 2008-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulator of g-protein signaling 9
    Species: Mus musculus [TaxId:10090]
    Gene: Rgs9
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Guanine nucleotide-binding protein subunit beta 5
    Species: Mus musculus [TaxId:10090]
    Gene: Gnb5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pbib_
  • Chain 'C':
    Compound: regulator of g-protein signaling 9
    Species: Mus musculus [TaxId:10090]
    Gene: Rgs9
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Guanine nucleotide-binding protein subunit beta 5
    Species: Mus musculus [TaxId:10090]
    Gene: Gnb5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62881 (1-353)
      • expression tag (0)
    Domains in SCOPe 2.08: d2pbid1, d2pbid2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pbiB (B:)
    gmatdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtl
    kghgnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgca
    iacggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcal
    wdvesgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethe
    sdvnsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllf
    agyndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pbiB (B:)
    netlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlkghgnkvlc
    mdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcaiacggldnk
    csvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalwdvesgqll
    qsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethesdvnsvryy
    psgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfagyndytin
    vwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pbiD (D:)
    gmatdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtl
    kghgnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgca
    iacggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcal
    wdvesgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethe
    sdvnsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllf
    agyndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa