PDB entry 2pbg

View 2pbg on RCSB PDB site
Description: 6-phospho-beta-d-galactosidase form-b
Deposited on 1997-02-21, released 1997-07-23
The last revision prior to the SCOP 1.63 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d2pbg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pbg_ (-)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghycdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
    vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
    wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie