PDB entry 2pb8

View 2pb8 on RCSB PDB site
Description: Crystal structure of the complex formed between phospholipase A2 and peptide Ala-Val-Tyr-Ser at 2.0 A resolution
Class: hydrolase
Keywords: Inhibitor, HYDROLASE
Deposited on 2007-03-28, released 2007-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOPe 2.08: d2pb8a_
• Chain 'P':
  Compound: avys
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2PB8 (0-3)
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pb8A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'P':
  No sequence available.