PDB entry 2pb7

View 2pb7 on RCSB PDB site
Description: Crystal Structure of the SRA domain of the human UHRF1 protein
Class: ligase
Keywords: beta barrel, new fold, LIGASE
Deposited on 2007-03-28, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF1, ICBP90, NP95, RNF106
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pb7a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pb7A (A:)
    ghmkectivpsnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlag
    gyeddvdhgnfftytgsggrdlsgnkrtaeqscdqkltntnralalncfapindqegaea
    kdwrsgkpvrvvrnvkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdd
    depgpwtkegkdrikklgltmqypegylealanrerekenskreeeeqqeggfasprtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pb7A (A:)
    ectivpsnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyed
    dvdhgnfftytgsggeqscdqkltntnralalncfapindqegaeakdwrsgkpvrvvrn
    vkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtkegkdri
    kklgltmqypegyleal