PDB entry 2pb2

View 2pb2 on RCSB PDB site
Description: Structure of biosynthetic N-acetylornithine aminotransferase from Salmonella typhimurium: studies on substrate specificity and inhibitor binding
Class: Transferase
Keywords: ArgD, Pyridoxal 5'-phosphate, Arginine metabolism, Lysine biosynthesis, Gabaculine, Transferase
Deposited on 2007-03-28, released 2007-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine/succinyldiaminopimelate aminotransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pb2a_
  • Chain 'B':
    Compound: Acetylornithine/succinyldiaminopimelate aminotransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pb2b_
  • Heterogens: PLP, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pb2A (A:)
    mrgshhhhhhgmashmateqtaitratfdevilpvyapadfipvkgkgsrvwdqqgkeyi
    dfaggiavtalghchpalvealksqgetlwhtsnvftnepalrlgrklidatfaervlfm
    nsgteanetafklarhyacvrhspfktkiiafhnafhgrslftvsvggqpkysdgfgpkp
    adiihvpfndlhavkavmddhtcavvvepiqgeggvqaatpeflkglrdlcdehqallvf
    devqcgmgrtgdlfaymhygvtpdiltsakalgggfpvsamlttqeiasafhvgshgsty
    ggnplacavagaafdiintpevlqgihtkrqqfvqhlqaideqfdifsdirgmglligae
    lkpkykgrardflyagaeagvmvlnagadvmrfapslvveeadihegmqrfaqavgkvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pb2A (A:)
    adfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwhtsnvftn
    epalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiafhnafhg
    rslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqgeggvqa
    atpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakalgggfpv
    samlttqeiasafhgstyggnplacavagaafdiintpevlqgihtkrqqfvqhlqaide
    qfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmrfapslvveea
    dihegmqrfaqavgkvva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pb2B (B:)
    mrgshhhhhhgmashmateqtaitratfdevilpvyapadfipvkgkgsrvwdqqgkeyi
    dfaggiavtalghchpalvealksqgetlwhtsnvftnepalrlgrklidatfaervlfm
    nsgteanetafklarhyacvrhspfktkiiafhnafhgrslftvsvggqpkysdgfgpkp
    adiihvpfndlhavkavmddhtcavvvepiqgeggvqaatpeflkglrdlcdehqallvf
    devqcgmgrtgdlfaymhygvtpdiltsakalgggfpvsamlttqeiasafhvgshgsty
    ggnplacavagaafdiintpevlqgihtkrqqfvqhlqaideqfdifsdirgmglligae
    lkpkykgrardflyagaeagvmvlnagadvmrfapslvveeadihegmqrfaqavgkvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pb2B (B:)
    lpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwht
    snvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiaf
    hnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqg
    eggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakal
    gggfpvsamlttqeiasafstyggnplacavagaafdiintpevlqgihtkrqqfvqhlq
    aideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmrfapslv
    veeadihegmqrfaqavgkvva