PDB entry 2pb1

View 2pb1 on RCSB PDB site
Description: Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A
Class: hydrolase
Keywords: exo-glucanase, candida albicans, mechanism-based inhibitor, hydrolase
Deposited on 2007-03-28, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein XOG1
    Species: Candida albicans [TaxId:5476]
    Gene: EXG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5AIZ3 (Start-399)
      • see remark 999 (63)
    Domains in SCOPe 2.08: d2pb1a_
  • Heterogens: G2F, NFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pb1A (A:)
    ggghnvawdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgk
    eaalrilqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekal
    gwarknnirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggney
    sdvvigiellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnflt
    vaegqwnvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdc
    akwlngvnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggw
    vfwswktenapewsfqtltynglfpqpvtdrqfpnqcgfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pb1A (A:)
    awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
    lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
    nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
    iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
    nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
    vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
    tenapewsfqtltynglfpqpvtdrqfpnqcgfh