PDB entry 2pak

View 2pak on RCSB PDB site
Description: Structure of a H51N mutant dTDP-4-keto-6-deoxy-D-glucose-3,4-ketoisomerase from Aneurinibacillus thermoaerophilus complexed with TDP
Class: isomerase
Keywords: deoxysugar biosynthesis, S-Layer biosynthesis, ketoisomerase
Deposited on 2007-03-27, released 2007-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DTDP-6-deoxy-3,4-keto-hexulose isomerase
    Species: Aneurinibacillus thermoaerophilus [TaxId:143495]
    Gene: fdtA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6T1W8
      • engineered (52)
    Domains in SCOPe 2.08: d2paka1
  • Chain 'B':
    Compound: DTDP-6-deoxy-3,4-keto-hexulose isomerase
    Species: Aneurinibacillus thermoaerophilus [TaxId:143495]
    Gene: fdtA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6T1W8
      • engineered (52)
    Domains in SCOPe 2.08: d2pakb_
  • Heterogens: TYD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pakA (A:)
    ghmenkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhankkleqvl
    vclngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetd
    yirqydnfkkyiakinlekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pakA (A:)
    enkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhankkleqvlvcl
    ngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyir
    qydnfkkyiakinle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pakB (B:)
    ghmenkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhankkleqvl
    vclngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetd
    yirqydnfkkyiakinlekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pakB (B:)
    enkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhankkleqvlvcl
    ngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyir
    qydnfkkyiakinl