PDB entry 2paj

View 2paj on RCSB PDB site
Description: Crystal structure of an amidohydrolase from an environmental sample of Sargasso sea
Class: hydrolase
Keywords: NYSGXRC, 9339a, PSI-II, amidohydrolase, Sargasso sea, environmental sample, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, HYDROLASE
Deposited on 2007-03-27, released 2007-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytosine/guanine deaminase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 2PAJ
    Domains in SCOPe 2.08: d2paja1, d2paja2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pajA (A:)
    mslttydtqpstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgeti
    vdatdcviypawvnthhhlfqsllkgepagldatltpwlaatpyrfralfderrfrlaar
    iglielarsgcatvadhnyvyypgmpfdssailfeeaeklglrfvllrggatqtrqlead
    lptalrpetldayvadierlaaryhdaspramrrvvmapttvlysispremretaavarr
    lglrmhshlsetvgyqdsaysmygkspvafcgehdwlgsdvwyahlvkvdadeiallaqt
    gtgvahcpqsngrlgsgicpvremadagvpvsigvdgaasneaadmisevhmtwlaqrar
    lgmlaqpayrggsfeggagaasiaevihwgtaggarvmgldevgkvavgyaadiavyrld
    dpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellr
    evvveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pajA (A:)
    pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy
    pawvnthhhlfqsllkgepfralfderrfrlaariglielarsgcatvadhnyvyypgmp
    fdssailfeeaeklglrfvllrggatqtrqleadlptalrpetldayvadierlaaryhd
    aspramrrvvmapttvlysispremretaavarrlglrmhshlsgkspvafcgehdwlgs
    dvwyahlvkvdadeiallaqtgtgvahcpqsngrlpvremadagvpvsigvdgaasneaa
    dmisevhmtwlaqrarlasiaevihwgtaggarvmgldevgkvavgyaadiavyrlddpr
    yfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevv
    v