PDB entry 2pa9

View 2pa9 on RCSB PDB site
Description: Human poly(ADP-ribose) polymerase 3, catalytic fragment in complex with an inhibitor 3-aminobenzoic acid
Class: transferase
Keywords: enzyme-inhibitor complex, catalytic fragment, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2007-03-27, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-06, with a file datestamp of 2009-01-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP3, ADPRT3, ADPRTL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6F1 (2-356)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2pa9a1, d2pa9a2, d2pa9a3
  • Heterogens: GAB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pa9A (A:)
    smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
    leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
    qalqavseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptl
    qhiwkvnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyf
    asensksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarght
    epdptqdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh