PDB entry 2pa3

View 2pa3 on RCSB PDB site
Description: crystal structure of serine bound G336V mutant of E.coli phosphoglycerate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, phosphoglycerate dehydrogenase, serine biosynthesis
Deposited on 2007-03-27, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: serA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (Start-409)
      • engineered (80)
      • engineered (82)
      • engineered (249)
      • engineered (281)
      • engineered (335)
    Domains in SCOPe 2.07: d2pa3a1, d2pa3a2, d2pa3a3
  • Heterogens: SER, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pa3A (A:)
    makvslekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglr
    srthltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigel
    llllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfy
    dienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasr
    gtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqea
    qeniglevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifae
    qgvniaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pa3A (A:)
    slekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrth
    ltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllll
    rgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydien
    klplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvv
    dipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqeni
    glevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifaeqgvn
    iaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly