PDB entry 2pa2

View 2pa2 on RCSB PDB site
Description: Crystal structure of human Ribosomal protein L10 core domain
Class: ribosomal protein
Keywords: ribosomal protein L10, QM protein, , Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-27, released 2008-03-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60S ribosomal protein L10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2pa2a1
  • Chain 'B':
    Compound: 60S ribosomal protein L10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2pa2b1
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pa2A (A:)
    gsfdlgrkkakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrl
    hpfhvirinkmlscagadrlqtgmrgafgkpqgtvarvhigqvimsirtklqnkehviea
    lrrakfkfpgrqkihiskkwgftkfnadefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pa2A (A:)
    kakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfgtvar
    vhigqvimsirtklqnkehviealrrakfkfpgrqkihiskkwgftkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pa2B (B:)
    gsfdlgrkkakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrl
    hpfhvirinkmlscagadrlqtgmrgafgkpqgtvarvhigqvimsirtklqnkehviea
    lrrakfkfpgrqkihiskkwgftkfnadefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pa2B (B:)
    kakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfgtvar
    vhigqvimsirtklqnkehviealrrakfkfpgrqkihiskkwgftkf