PDB entry 2p9t

View 2p9t on RCSB PDB site
Description: Crystal Structure of Phosphoglycerate Kinase-2 bound to 3-phosphoglycerate
Class: transferase
Keywords: transferase, phosphoglycerate kinse, enzyme-substrate complex
Deposited on 2007-03-26, released 2007-11-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase, testis specific
    Species: Mus musculus [TaxId:10090]
    Gene: Pgk2, Pgk-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09041 (Start-415)
      • see remark 999 (149)
    Domains in SCOPe 2.04: d2p9ta_
  • Heterogens: 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p9tA (A:)
    alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
    shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
    lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
    pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
    ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
    tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
    atsngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9tA (A:)
    akltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlmshl
    grpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillenlrf
    hveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnlpqk
    asgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggmaytf
    lkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqatie
    sgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvkats
    ngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm