PDB entry 2p9q

View 2p9q on RCSB PDB site
Description: Crystal Structure of Phosphoglycerate Kinase-2
Class: transferase
Keywords: transferase, phosphoglycerate kinase
Deposited on 2007-03-26, released 2007-11-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase, testis specific
    Species: Mus musculus [TaxId:10090]
    Gene: Pgk2, Pgk-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09041 (0-415)
      • see remark 999 (149)
    Domains in SCOPe 2.02: d2p9qa_
  • Chain 'B':
    Compound: Phosphoglycerate kinase, testis specific
    Species: Mus musculus [TaxId:10090]
    Gene: Pgk2, Pgk-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09041 (0-415)
      • see remark 999 (149)
    Domains in SCOPe 2.02: d2p9qb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p9qA (A:)
    alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
    shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
    lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
    pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
    ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
    tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
    atsngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9qA (A:)
    alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
    shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
    lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
    pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
    ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
    tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
    atsngcvtiiggedkvshvstgggaslellegkilpgvealsnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p9qB (B:)
    alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
    shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
    lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
    pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
    ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
    tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
    atsngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9qB (B:)
    alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
    shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
    lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
    pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
    ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
    tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
    atsngcvtiigedkvshvstgggaslellegkilpgvealsnm