PDB entry 2p9j

View 2p9j on RCSB PDB site
Description: Crystal structure of AQ2171 from Aquifex aeolicus
Class: structural genomics, unknown function
Keywords: AQ2171, SECSG, RIKEN, PSI, Aquifex aeolicus, Structural Genomics, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2007-03-26, released 2007-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AQ2171
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: aq_2171
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67920 (0-End)
      • modified residue (13)
      • modified residue (50)
      • modified residue (115)
    Domains in SCOPe 2.07: d2p9ja_
  • Chain 'B':
    Compound: Hypothetical protein AQ2171
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: aq_2171
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67920 (0-161)
      • modified residue (13)
      • modified residue (50)
      • modified residue (115)
    Domains in SCOPe 2.07: d2p9jb_
  • Chain 'C':
    Compound: Hypothetical protein AQ2171
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: aq_2171
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67920 (0-161)
      • modified residue (13)
      • modified residue (50)
      • modified residue (115)
    Domains in SCOPe 2.07: d2p9jc_
  • Chain 'D':
    Compound: Hypothetical protein AQ2171
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: aq_2171
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67920 (0-End)
      • modified residue (13)
      • modified residue (50)
      • modified residue (115)
    Domains in SCOPe 2.07: d2p9jd_
  • Chain 'E':
    Compound: Hypothetical protein AQ2171
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: aq_2171
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67920 (0-End)
      • modified residue (13)
      • modified residue (50)
      • modified residue (115)
    Domains in SCOPe 2.07: d2p9je_
  • Chain 'F':
    Compound: Hypothetical protein AQ2171
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: aq_2171
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67920
      • modified residue (13)
      • modified residue (50)
      • modified residue (115)
    Domains in SCOPe 2.07: d2p9jf_
  • Chain 'G':
    Compound: Hypothetical protein AQ2171
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: aq_2171
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67920 (0-End)
      • modified residue (13)
      • modified residue (50)
      • modified residue (115)
    Domains in SCOPe 2.07: d2p9jg_
  • Chain 'H':
    Compound: Hypothetical protein AQ2171
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: aq_2171
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67920 (0-End)
      • modified residue (13)
      • modified residue (50)
      • modified residue (115)
    Domains in SCOPe 2.07: d2p9jh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p9jA (A:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflknd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9jA (A:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgskleiyekikekyslkdeeigfigddvvdievmkkvgfp
    vavrnaveevrkvavyitqrnggegalrevaelihflk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p9jB (B:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflknd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p9jC (C:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflknd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p9jD (D:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflknd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9jD (D:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflkn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p9jE (E:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflknd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9jE (E:)
    alrdrvkklkllimdidgvltdgklyytikvfnvldgigikllqkmgitlavisgsapli
    trlkelgveeiytgskkleiyekikekyslkdeeigfigddvvdievmkkvgfpvavrna
    veevrkvavyitqrnggegalrevaelihflkn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2p9jF (F:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflknd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9jF (F:)
    lrdrvkklkllimdidgvltdgklyytikvfnvldgigikllqkmgitlavisgaplitr
    lkelgveeiytgsykleiyekikekyslkdeeigfigddvvdievmkkvgfpvavrnave
    evrkvavyitqrnggegalrevaelihflkn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2p9jG (G:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflknd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9jG (G:)
    alrdrvkklkllimdidgvltdgklyytikvfnvldgigikllqkmgitlavisgrdsli
    trlkelgveeiytgkleiyekikekyslkdeeigfigddvvdievmkkvgfpvavrnave
    evrkvavyitqrnggegalrevaelihfl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2p9jH (H:)
    alrdrvkklkllimdidgvltdgklyytehgetikvfnvldgigikllqkmgitlavisg
    rdsaplitrlkelgveeiytgsykkleiyekikekyslkdeeigfigddvvdievmkkvg
    fpvavrnaveevrkvavyitqrnggegalrevaelihflknd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9jH (H:)
    alrdrvkklkllimdidgvltdgklyyteetikvfnvldgigikllqkmgitlavisgrd
    saplitrlkelgveeiytgkkleiyekikekyslkdeeigfigddvvdievmkkvgfpva
    vrnaveevrkvavyitqrnggegalrevaelihflk