PDB entry 2p9c

View 2p9c on RCSB PDB site
Description: Crystal structure of serine bound G336V mutant of E.coli phosphoglycerate dehydrogenase
Class: oxidoreductase
Keywords: Oxidoreductase, phosphoglycerate dehydrogenase
Deposited on 2007-03-24, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: serA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (Start-409)
      • engineered (80)
      • engineered (82)
      • engineered (249)
      • engineered (281)
      • engineered (335)
    Domains in SCOPe 2.07: d2p9ca1, d2p9ca2, d2p9ca3
  • Chain 'B':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: serA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (Start-409)
      • engineered (80)
      • engineered (82)
      • engineered (249)
      • engineered (281)
      • engineered (335)
    Domains in SCOPe 2.07: d2p9cb1, d2p9cb2, d2p9cb3
  • Heterogens: NAI, SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p9cA (A:)
    makvslekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglr
    srthltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigel
    llllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfy
    dienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasr
    gtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqea
    qeniglevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifae
    qgvniaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9cA (A:)
    lekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthl
    tedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllr
    gvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienk
    lplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvd
    ipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqenig
    levagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifaeqgvni
    aaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p9cB (B:)
    makvslekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglr
    srthltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigel
    llllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfy
    dienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasr
    gtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqea
    qeniglevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifae
    qgvniaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9cB (B:)
    lekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthl
    tedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllr
    gvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienk
    lplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvd
    ipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqenig
    levagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifaeqgvni
    aaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly