PDB entry 2p99

View 2p99 on RCSB PDB site
Description: E. coli methionine aminopeptidase monometalated with inhibitor YE6
Class: Hydrolase
Keywords: monometalated, mononuclear, Mn(II)-form, hydrolase, enzyme-inhibitor complex, metalloenzyme
Deposited on 2007-03-24, released 2007-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.227
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p99a_
  • Heterogens: MN, NA, YE6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p99A (A:)
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiish