PDB entry 2p97

View 2p97 on RCSB PDB site
Description: crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution
Class: metal binding protein
Keywords: putative metal-dependent hydrolase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, metal binding protein
Deposited on 2007-03-23, released 2007-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Anabaena variabilis [TaxId:240292]
    Gene: YP_323572.1, Ava_3068
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3M8K9 (1-200)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (112)
      • modified residue (155)
    Domains in SCOPe 2.08: d2p97a1, d2p97a2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Anabaena variabilis [TaxId:240292]
    Gene: YP_323572.1, Ava_3068
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3M8K9 (1-200)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (112)
      • modified residue (155)
    Domains in SCOPe 2.08: d2p97b2, d2p97b3
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p97A (A:)
gmkslhrpdlyswstfnparnidfngfawirpegnilidpvalsnhdwkhleslggvvwi
vltnsdhvrsakeiadqtytkiagpvaekenfpiycdrwlsdgdelvpglkvmelqgskt
pgelallleettlitgdlvrayraggleilpdeklmnkqkvvasvrrlaalekveavlvg
dgwsvfrdgrdrlkelvatla

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p97B (B:)
gmkslhrpdlyswstfnparnidfngfawirpegnilidpvalsnhdwkhleslggvvwi
vltnsdhvrsakeiadqtytkiagpvaekenfpiycdrwlsdgdelvpglkvmelqgskt
pgelallleettlitgdlvrayraggleilpdeklmnkqkvvasvrrlaalekveavlvg
dgwsvfrdgrdrlkelvatla