PDB entry 2p91

View 2p91 on RCSB PDB site
Description: Crystal structure of Enoyl-[acyl-carrier-protein] reductase (NADH) from Aquifex aeolicus VF5
Class: oxidoreductase
Keywords: NADH-dependent enoyl-ACP reductase, aq_1552, fabI, Aquifex aeolicus VF5, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, RSGI, OXIDOREDUCTASE
Deposited on 2007-03-23, released 2007-04-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: fabI, aq_1552
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2p91a_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: fabI, aq_1552
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2p91b_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: fabI, aq_1552
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2p91c_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: fabI, aq_1552
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2p91d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p91A (A:)
    mlrklskfsnkgevfmgllegkralitgvanersiaygiaksfhregaqlaftyatpkle
    krvreiakgfgsdlvvkcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvi
    dtsregfkiamdisvyslialtrellplmegrngaivtlsyygaekvvphynvmgiakaa
    lestvrylaydiakhghrinaisagpvktlaaysitgfhllmehttkvnpfgkpitiedv
    gdtavflcsdwaraitgevvhvdngyhimgvfgreeeikkevygd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p91A (A:)
    gllegkralitgvanersiaygiaksfhregaqlaftyatpklekrvreiakgfgsdlvv
    kcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvidtsregfkiamdisvy
    slialtrellplmegrngaivtlsyygaekvvphynvmgiakaalestvrylaydiakhg
    hrinaisagpvktlaaitgfhllmehttkvnpfgkpitiedvgdtavflcsdwaraitge
    vvhvdngyhimgvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p91B (B:)
    mlrklskfsnkgevfmgllegkralitgvanersiaygiaksfhregaqlaftyatpkle
    krvreiakgfgsdlvvkcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvi
    dtsregfkiamdisvyslialtrellplmegrngaivtlsyygaekvvphynvmgiakaa
    lestvrylaydiakhghrinaisagpvktlaaysitgfhllmehttkvnpfgkpitiedv
    gdtavflcsdwaraitgevvhvdngyhimgvfgreeeikkevygd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p91B (B:)
    gllegkralitgvanersiaygiaksfhregaqlaftyatpklekrvreiakgfgsdlvv
    kcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvidtsregfkiamdisvy
    slialtrellplmegrngaivtlsyygaekvvphynvmgiakaalestvrylaydiakhg
    hrinaisagpvktlaatgfhllmehttkvnpfgkpitiedvgdtavflcsdwaraitgev
    vhvdngyhimgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p91C (C:)
    mlrklskfsnkgevfmgllegkralitgvanersiaygiaksfhregaqlaftyatpkle
    krvreiakgfgsdlvvkcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvi
    dtsregfkiamdisvyslialtrellplmegrngaivtlsyygaekvvphynvmgiakaa
    lestvrylaydiakhghrinaisagpvktlaaysitgfhllmehttkvnpfgkpitiedv
    gdtavflcsdwaraitgevvhvdngyhimgvfgreeeikkevygd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p91C (C:)
    llegkralitgvanersiaygiaksfhregaqlaftyatpklekrvreiakgfgsdlvvk
    cdvsldediknlkkfleenwgsldiivhsiayapkeefkggvidtsregfkiamdisvys
    lialtrellplmegrngaivtlsyygaekvvphynvmgiakaalestvrylaydiakhgh
    rinaisagpvpitiedvgdtavflcsdwaraitgevvhvdngyhimgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p91D (D:)
    mlrklskfsnkgevfmgllegkralitgvanersiaygiaksfhregaqlaftyatpkle
    krvreiakgfgsdlvvkcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvi
    dtsregfkiamdisvyslialtrellplmegrngaivtlsyygaekvvphynvmgiakaa
    lestvrylaydiakhghrinaisagpvktlaaysitgfhllmehttkvnpfgkpitiedv
    gdtavflcsdwaraitgevvhvdngyhimgvfgreeeikkevygd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p91D (D:)
    gllegkralitgvanersiaygiaksfhregaqlaftyatpklekrvreiakgfgsdlvv
    kcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvidtsregfkiamdisvy
    slialtrellplmegrngaivtlsyygaekvvphynvmgiakaalestvrylaydiakhg
    hrinaisagpvkfgkpitiedvgdtavflcsdwaraitgevvhvdngyhimgv