PDB entry 2p8x

View 2p8x on RCSB PDB site
Description: Fitted structure of ADPR-eEF2 in the 80S:ADPR-eEF2:GDPNP cryo-EM reconstruction
Class: translation
Keywords: elongation, translocation, GTPase, 80S ribosome, TRANSLATION
Deposited on 2007-03-23, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: EM
Resolution: 9.7 Å
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Compound: Elongation factor Tu-B
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOPe 2.07: d2p8xt1, d2p8xt2, d2p8xt3, d2p8xt4, d2p8xt5
  • Heterogens: APR, GNP

PDB Chain Sequences:

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2p8xT (T:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p8xT (T:)
    aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse
    msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte
    tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv
    qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk
    dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall
    kvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlml
    yvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgr
    fvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknand
    lpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkisppv
    vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
    ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
    mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkilveiqcpeqavggiys
    vlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqafpqmvfdhwstlgsdp
    ldptskageivlaarkrhgmkeevpgwqeyydkl