PDB entry 2p8n

View 2p8n on RCSB PDB site
Description: Ricin a-chain (recombinant) complex with adenine
Class: hydrolase
Keywords: ricin; ricinus communis; n-glycosidase; toxin, hydrolase
Deposited on 2007-03-22, released 2007-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.265
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin a chain
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p8na_
  • Heterogens: SO4, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p8nA (A:)
    mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
    velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
    ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
    rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
    fsvydvsilipiialmvyrcapppssqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p8nA (A:)
    ypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsnh
    aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
    leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyie
    gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
    silipiialmvyrcappp