PDB entry 2p8m

View 2p8m on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELLELDKWASLWN in new crystal form
Class: viral protein
Keywords: nmAb 2F5, HIV-1, gp41 epitope, viral protein
Deposited on 2007-03-22, released 2007-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nmAb 2F5, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P8M (0-End)
  • Chain 'B':
    Compound: nmAb 2F5, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P8M (0-End)
    Domains in SCOPe 2.04: d2p8mb1, d2p8mb2
  • Chain 'C':
    Compound: gp41 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2P8M (0-End)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p8mB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstaggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p8mB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgptgpvnamdvwgqgitvt
    isststkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtytcnvnhkpsntkvdkrvep
    

  • Chain 'C':
    No sequence available.