PDB entry 2p8l

View 2p8l on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELLELDKWASLWN
Class: viral protein
Keywords: nmAb 2F5, HIV-1, gp41 epitope
Deposited on 2007-03-22, released 2007-05-15
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.201
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nmAb 2F5, light chain
    Species: HOMO SAPIENS
  • Chain 'B':
    Compound: nmAb 2F5, heavy chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d2p8lb1, d2p8lb2
  • Chain 'C':
    Compound: gp41 peptide
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p8lB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstaggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p8lB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslqtytcnvnhkpsntkvdkrvep
    

  • Chain 'C':
    No sequence available.