PDB entry 2p8g

View 2p8g on RCSB PDB site
Description: Crystal structure of phenolic acid decarboxylase (2635953) from Bacillus subtilis at 1.36 A resolution
Class: lyase
Keywords: 2635953, Phenolic acid decarboxylase (PAD), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, LYASE
Deposited on 2007-03-22, released 2007-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phenolic acid decarboxylase
  Species: Bacillus subtilis [TaxId:1423]
  Gene: padC, pad, BSU34400
  Database cross-references and differences (RAF-indexed):
  • Uniprot O07006 (1-161)
    • leader sequence (0)
    • modified residue (1)
    • modified residue (9)
    • modified residue (37)
    • modified residue (75)
    • modified residue (81)
    • modified residue (109)
    • engineered (146)
    • modified residue (152)
  Domains in SCOPe 2.08: d2p8ga1, d2p8ga2
• Heterogens: EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p8gA (A:)
  gmenfigshmiytyengweyeiyikndhtidyrihsgmvagrwvrdqevnivkltegvyk
  vswteptgtdvslnfmpnekrmhgiiffpkwvhehpeitvcyqndhidlmkesrekyety
  pkyvvpefaeitflknegvdneevisyapyegmtddiragrl