PDB entry 2p85

View 2p85 on RCSB PDB site
Description: Structure of Human Lung Cytochrome P450 2A13 with indole bound in two alternate conformations
Class: oxidoreductase
Keywords: CYP2A13, P450 2A13, P450, monooxygenase, nicotine oxidase, coumarine 7-hydroxylase, NNK oxidase, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone oxidase, oxidoreductase, heme
Deposited on 2007-03-21, released 2007-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.219
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p85a_
  • Chain 'B':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p85b_
  • Chain 'C':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p85c_
  • Chain 'D':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p85d_
  • Chain 'E':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p85e_
  • Chain 'F':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p85f_
  • Heterogens: HEM, IND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p85A (A:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p85A (A:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p85B (B:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p85B (B:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p85C (C:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p85C (C:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p85D (D:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p85D (D:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p85E (E:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p85E (E:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2p85F (F:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p85F (F:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr