PDB entry 2p7v

View 2p7v on RCSB PDB site
Description: Crystal structure of the Escherichia coli regulator of sigma 70, Rsd, in complex with sigma 70 domain 4
Class: transcription
Keywords: Rsd, sigma 70, Regulator of sigma 70, sigma 70 domain 4, transcription, regulation, Helix-turn-helix, Rsd-sigma 70 complex, sigma factor, Escherichia coli Rsd-sigma 70 complex, E. coli Rsd-sigma 70 complex
Deposited on 2007-03-20, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of sigma D
  Species: Escherichia coli [TaxId:562]
  Gene: rsd
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AFX4 (0-157)
• Chain 'B':
  Compound: RNA polymerase sigma factor rpoD
  Species: Escherichia coli [TaxId:562]
  Gene: rpoD, alt
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00579 (0-67)
  Domains in SCOPe 2.07: d2p7vb_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p7vB (B:)
  dvlagltareakvlrmrfgidmntdytleevgkqfdvtrerirqieakalrklrhpsrse
  vlrsfldd