PDB entry 2p71

View 2p71 on RCSB PDB site
Description: Bombyx mori pheromone binding protein bound to iodohexadecane
Class: attractant
Keywords: alpha-helical, binding pocket, liganded
Deposited on 2007-03-19, released 2007-04-10
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Bombyx mori
    Gene: pheromone binding protein
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2p71a1
  • Heterogens: IHD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p71A (A:)
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmd