PDB entry 2p6z

View 2p6z on RCSB PDB site
Description: Enzymatic and Structural Characterisation of Amphinase, a Novel Cytotoxic Ribonuclease from Rana pipiens Oocytes
Class: hydrolase
Keywords: Amphinase, cytotoxic RNase, enzyme efficiency, substrate specificity, HYDROLASE
Deposited on 2007-03-19, released 2007-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recombinant Amphinase-2
    Species: Rana pipiens [TaxId:8404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p6za_
  • Chain 'B':
    Compound: Recombinant Amphinase-2
    Species: Rana pipiens [TaxId:8404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p6zb_
  • Heterogens: NA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p6zA (A:)
    mkpkedrewekfktkhitsqsvadfncnrtmndpaytpdgqckpintfihsttgpvkeic
    rratgrvnksstqqftlttcknpirckysqsnttnficitcrdnypvhfvktgkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6zA (A:)
    kedrewekfktkhitsqsvadfncnrtmndpaytpdgqckpintfihsttgpvkeicrra
    tgrvnksstqqftlttcknpirckysqsnttnficitcrdnypvhfvktgkc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p6zB (B:)
    mkpkedrewekfktkhitsqsvadfncnrtmndpaytpdgqckpintfihsttgpvkeic
    rratgrvnksstqqftlttcknpirckysqsnttnficitcrdnypvhfvktgkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6zB (B:)
    drewekfktkhitsqsvadfncnrtmndpaytpdgqckpintfihsttgpvkeicrratg
    rvnksstqqftlttcknpirckysqsnttnficitcrdnypvhfvktgkc