PDB entry 2p6p

View 2p6p on RCSB PDB site
Description: X-ray crystal structure of C-C bond-forming dTDP-D-Olivose-transferase UrdGT2
Class: transferase
Keywords: C-glycosyltransferase,dTDP-D-Olivose-transferase,polyketide aglycon, GT-B family, X-ray-diffraction,UrdamycinA-biosynthesis, TRANSFERASE
Deposited on 2007-03-19, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosyl transferase
    Species: Streptomyces fradiae [TaxId:1906]
    Gene: urdGT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p6pa1, d2p6pa2
  • Chain 'B':
    Compound: glycosyl transferase
    Species: Streptomyces fradiae [TaxId:1906]
    Gene: urdGT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2p6pb1, d2p6pb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p6pA (A:)
    mrilfvaagspatvfalaplataarnaghqvvmaanqdmgpvvtgvglpavattdlpirh
    fittdregrpeaipsdpvaqarftgrwfarmaasslprmldfsrawrpdlivggtmsyva
    pllalhlgvpharqtwdavdadgihpgadaelrpelselglerlpapdlfidicppslrp
    anaaparmmrhvatsrqcplepwmytrdtrqrvlvtsgsrvakesydrnfdflrglakdl
    vrwdvelivaapdtvaealraevpqarvgwtpldvvaptcdllvhhaggvstltglsagv
    pqllipkgsvleaparrvadygaaiallpgedsteaiadscqelqakdtyarraqdlsre
    isgmplpatvvtaleqlahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6pA (A:)
    mrilfvaagspatvfalaplataarnaghqvvmaanqdmgpvvtgvglpavattdlpirh
    fittdregrpeaipsdpvaqarftgrwfarmaasslprmldfsrawrpdlivggtmsyva
    pllalhlgvpharqtwdavdadgihpgadaelrpelselglerlpapdlfidicppslrp
    anaaparmmrhvatsrqcplepwmytrdtrqrvlvtsgsrvakesydrnfdflrglakdl
    vrwdvelivaapdtvaealraevpqarvgwtpldvvaptcdllvhhaggvstltglsagv
    pqllipkgsvleaparrvadygaaiallpgedsteaiadscqelqakdtyarraqdlsre
    isgmplpatvvtaleqlahhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p6pB (B:)
    mrilfvaagspatvfalaplataarnaghqvvmaanqdmgpvvtgvglpavattdlpirh
    fittdregrpeaipsdpvaqarftgrwfarmaasslprmldfsrawrpdlivggtmsyva
    pllalhlgvpharqtwdavdadgihpgadaelrpelselglerlpapdlfidicppslrp
    anaaparmmrhvatsrqcplepwmytrdtrqrvlvtsgsrvakesydrnfdflrglakdl
    vrwdvelivaapdtvaealraevpqarvgwtpldvvaptcdllvhhaggvstltglsagv
    pqllipkgsvleaparrvadygaaiallpgedsteaiadscqelqakdtyarraqdlsre
    isgmplpatvvtaleqlahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6pB (B:)
    mrilfvaagspatvfalaplataarnaghqvvmaanqdmgpvvtgvglpavattdlpirh
    fittdregrpeaipsdpvaqarftgrwfarmaasslprmldfsrawrpdlivggtmsyva
    pllalhlgvpharqtwdavdadgihpgadaelrpelselglerlpapdlfidicppslrp
    anaaparmmrhvatsrqcplepwmytrdtrqrvlvtsgdrnfdflrglakdlvrwdveli
    vaapdtvaealraevpqarvgwtpldvvaptcdllvhhaggvstltglsagvpqllipkg
    svleaparrvadygaaiallpgedsteaiadscqelqakdtyarraqdlsreisgmplpa
    tvvtaleqlahhhhhh