PDB entry 2p6b

View 2p6b on RCSB PDB site
Description: Crystal Structure of Human Calcineurin in Complex with PVIVIT Peptide
Class: hydrolase/hydrolase regulator
Keywords: Beta-sheet Augmentation; Protein-peptide Complex, HYDROLASE/HYDROLASE REGULATOR COMPLEX
Deposited on 2007-03-16, released 2007-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin-dependent calcineurin A subunit alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP3CA, CALNA, CNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p6ba_
  • Chain 'B':
    Compound: Calcineurin subunit B isoform 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP3R1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p6bb1
  • Chain 'C':
    Compound: Calmodulin-dependent calcineurin A subunit alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP3CA, CALNA, CNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p6bc_
  • Chain 'D':
    Compound: Calcineurin subunit B isoform 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP3R1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p6bd1
  • Chain 'E':
    Compound: PVIVIT 14-mer Peptide
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2P6B
  • Heterogens: ZN, FE, PO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p6bA (A:)
    gshmsepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrle
    esvalriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflg
    dyvdrgyfsiecvlylwalkilypktlfllrgnhecrhlteyftfkqeckikyservyda
    cmdafdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdple
    dfgnektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqtt
    gfpslitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfv
    gekvtemlvnvlnicsddelgse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6bA (A:)
    tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
    qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
    walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
    qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
    rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
    vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p6bB (B:)
    mdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfke
    fiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivd
    ktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6bB (B:)
    dadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfkef
    iegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivdk
    tiinadkdgdgrisfeefcavvggld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p6bC (C:)
    gshmsepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrle
    esvalriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflg
    dyvdrgyfsiecvlylwalkilypktlfllrgnhecrhlteyftfkqeckikyservyda
    cmdafdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdple
    dfgnektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqtt
    gfpslitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfv
    gekvtemlvnvlnicsddelgse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6bC (C:)
    tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
    qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
    walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
    qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
    rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
    vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p6bD (D:)
    mdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfke
    fiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivd
    ktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6bD (D:)
    dadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfkef
    iegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivdk
    tiinadkdgdgrisfeefcavvggldihkkmvv
    

  • Chain 'E':
    No sequence available.