PDB entry 2p68

View 2p68 on RCSB PDB site
Description: Crystal Structure of aq_1716 from Aquifex Aeolicus VF5
Class: oxidoreductase
Keywords: aq_1716, 3-ketoacyl-acyl carrier protein reductase, 3-oxoacyl-[acyl-carrier-protein] reductase, Aquifex aeolicus VF5, structural genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, RSGI, OXIDOREDUCTASE
Deposited on 2007-03-16, released 2007-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: fabG, aq_1716
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2p68a_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: fabG, aq_1716
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2p68b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p68A (A:)
    meiklqgkvslvtgstrgigraiaeklasagstviitgtsgerakavaeeiankygvkah
    gvemnllseesinkafeeiynlvdgidilvnnagitrdklflrmslldweevlkvnltgt
    flvtqnslrkmikqrwgrivnissvvgftgnvgqvnysttkagligftkslakelaprnv
    lvnavapgfietdmtavlseeikqkykeqiplgrfgspeevanvvlflcselasyitgev
    ihvnggmf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p68B (B:)
    meiklqgkvslvtgstrgigraiaeklasagstviitgtsgerakavaeeiankygvkah
    gvemnllseesinkafeeiynlvdgidilvnnagitrdklflrmslldweevlkvnltgt
    flvtqnslrkmikqrwgrivnissvvgftgnvgqvnysttkagligftkslakelaprnv
    lvnavapgfietdmtavlseeikqkykeqiplgrfgspeevanvvlflcselasyitgev
    ihvnggmf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p68B (B:)
    eiklqgkvslvtgstrgigraiaeklasagstviitgtsgerakavaeeiankygvkahg
    vemnllseesinkafeeiynlvdgidilvnnagitrdklflrmslldweevlkvnltgtf
    lvtqnslrkmikqrwgrivnissvvgftgnvgqvnysttkagligftkslakelaprnvl
    vnavapgfietdmtavlqkykeqiplgrfgspeevanvvlflcselasyitgevih