PDB entry 2p65

View 2p65 on RCSB PDB site
Description: Crystal Structure of the first nucleotide binding domain of chaperone ClpB1, putative, (Pv089580) from Plasmodium Vivax
Class: structural genomics, unknown function
Keywords: ClpB, plasmodium, malaria, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2007-03-16, released 2007-04-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.203
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PF08_0063
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PV089580:Y168-S353
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IB03 (Start-186)
      • conflict (28)
      • conflict (85)
    Domains in SCOPe 2.01: d2p65a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p65A (A:)
    gyqalekysrdltalaragkldpvigrdteirraiqilsrrtknnpillgdpgvgktaiv
    eglaikivqgdvpdslkgrklvsldlssliagakyrgdfeerlksilkevqdaegqvvmf
    ideihtvvgagavaegaldagnilkpmlargelrcigattvseyrqfiekdkalerrfqq
    ilveqps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p65A (A:)
    qalekysrdltalaragkldpvigrdteirraiqilsrrtknnpillgdpgvgktaiveg
    laikivqgdvpdslkgrklvsldlssliagakyrgdfeerlksilkevqdaegqvvmfid
    eihtvvgagavaegaldagnilkpmlargelrcigattvseyrqfiekdkalerrfqqil
    veqps